PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi02g11760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family SBP
Protein Properties Length: 427aa    MW: 46622.4 Da    PI: 8.4147
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi02g11760.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP79.16.7e-25169220253
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETT CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhels 53 
                      CqvegC  dls+ak+yhr+h+vCe+hsk+p+vlv+gle+rfCqqCsrf  ls
  Vradi02g11760.1 169 CQVEGCGLDLSSAKDYHRKHRVCEAHSKSPKVLVAGLERRFCQQCSRFSCLS 220
                      ************************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-25161220IPR004333Transcription factor, SBP-box
PROSITE profilePS5114120.332166266IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.1E-24167221IPR004333Transcription factor, SBP-box
PfamPF031104.7E-19169265IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MEWNAKSLGQ WDWEHLFFFN TKATENPRLP TTDCSNEADR EINVGVFYPS GGSACSGSEL  60
VHASSPRSSK SASNNSLSNG DSKASVLTLE GSQDDSTGKK ELCPVETSQS AVPSPVSGEP  120
LLTLKLGKRL YFEDVCAGSD SKKASSFEVP ISSGKKYKTS NQNLQHPSCQ VEGCGLDLSS  180
AKDYHRKHRV CEAHSKSPKV LVAGLERRFC QQCSRFSCLS RSYQINWFKL FPLNYLVEGS  240
MLCQSLMTKK EAAENVSDHN ARRRKPQPDS VQINPSALSS SPYGITKTFL SLGKSTVFVL  300
LLGLDGRQMM SPFAFSRSAT NLGWQDMHSN KLPQTKDFLP KPAKAFDKIP SIISMFSDDN  360
SGLLTSKSIA AKTIVPGLED PNSISSCDPN GAQDVNRALS LLSSNSWAPY ETKDDNRTFP  420
RISSII*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A4e-19169219656squamosa promoter-binding protein-like 12
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007163771.10.0hypothetical protein PHAVU_001G262600g
TrEMBLA0A0L9T4F10.0A0A0L9T4F1_PHAAN; Uncharacterized protein
TrEMBLA0A0S3S1D30.0A0A0S3S1D3_PHAAN; Uncharacterized protein
STRINGGLYMA18G00903.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46303058
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.31e-41squamosa promoter binding protein-like 2